109,879 Free Images of Us

cc-zerovehiclefiles uploaded by daderotmilitaryaircraftnavyplantspages with mapsjetanimals
Gamla Strandgatan 6, Gamlestan, Lysekil
wooden houses in lysekil municipalitygamlestan
Flight of Night by Paul Howard Manship, 1916, bronze - New Britain Museum of American Art - DSC09683
self-published workpd us expired
Gun removed from the USS Constitution at Boston 1931 - World War I Memorial - Belmont, MA - DSC09131
self-published workpd us not renewed
Geiger counter dosimeter measuring radiation - This photo has been released into the public domain. There are no copyrights you can use and modify this photo without asking, and without attribution
geiger counterradiation
Gemeindehaus Nordend Altarbereich
interiorinside
Mendel-nachsued
sidewalkpavement
Hospital Steward's Service Coat, US Hospital Corps, 1898 - Wisconsin Veterans Museum - DSC02969
self-published workcc-zero
Komatsu, evil woman devoured by a wolf, by Ito Seiu - Edo-Tokyo Museum - Sumida, Tokyo, Japan - DSC06873
self-published workindoor
The rearview of MUGEN LEGEND (KB1) used as a safety car of Suzuka Circuit
vehiclecar
Replica of German armored SdKfz. 25slash19 (made using OT-810) with 7.5 cm STUK 37 pic4
vehiclecc-zero
Twilight of the Gods by Lewis W. Rubenstein, painted 1930, unveiled 1937, fresco top section - Adolphus Busch Hall - Harvard University - DSC05650
self-published workpd us not renewed
Twilight of the Gods by Lewis W. Rubenstein, painted 1930, unveiled 1937, fresco left section - Adolphus Busch Hall - Harvard University - DSC05654
self-published workpd us not renewed
Sprayers and other tools - Northeast States Civilian Conservation Corps Museum - Shenipsit State Forest - Stafford Springs, Connecticut - DSC04256
self-published workpd us no notice
T-33 Shooting Star, Luftwaffe 95+20, here in US Navy colors
militaryvehicle
The frontview of MUGEN LEGEND (KB1) used as a safety car of Suzuka Circuit
vehiclecar
Views on 28th June 2019 around an old villa that was used as an Islamic State base and then PMF base in Sinjar's old city 46
islamic state of iraq and the levantself-published work
Views on 28th June 2019 around an old villa that was used as an Islamic State base and then PMF base in Sinjar's old city 30
islamic state of iraq and the levantself-published work
Views on 28th June 2019 around an old villa that was used as an Islamic State base and then PMF base in Sinjar's old city 29
islamic state of iraq and the levantself-published work
Head of a Finnish Boy (Portrait of Alwin Jussila), by Walker Hancock, c. 1939, plaster with painted patina - Cape Ann Museum - Gloucester, MA - DSC01317
self-published workpd us not renewed
Glass phonograph disk with photographic emulsion, Alexander Graham Bell, made November 17, 1885 - National Museum of American History - DSC00110
self-published workcircle
Water and algae in Norra Grundsund by the light of a flashlight
plants in lysekil municipalitynorra grundsund
Wien Linie 71 03 Am Heumarkt a
heldendenkmal der roten armeevehicle
Kaneyama castle sannomaru
sunshinetree
Praying Woman by Erich Heckel, 1916, tempera on canvas - Germanisches Nationalmuseum - Nuremberg, Germany - DSC02451
self-published workpd us expired
Speed control highway
truckroads
2001 9 11 brand
travelcity
Nuclear atom bomb xenophobe
bombusa
Auto waste old
backgroundvehicle
Reflect light bulb thoughts flash
planetmale
Iwatch apple white
technologybusiness
Sunset plane jet
vehiclesea
Military uss george washington sunset
militaryvehicle
Flight operations aboard USS Bonhomme Richard 120913-N-KB563-120
militaryvehicle
F6F-3 on USS Yorktown 1943
militaryvehicle
The rearview of Honda Accord Tourer (DBA-CW2) used as a race control car of Suzuka Circuit
vehiclecar
US Model muskets and rifles - Bennington Museum - Bennington, VT - DSC09151
self-published workwood
US Mail Coach jeh
2010 manhattan photos by jim.hendersonpages with maps
Replica of German armored SdKfz. 25slash19 (made using OT-810) with 7.5 cm STUK 37 pic1
vehiclecc-zero
Replica of German armored SdKfz. 25slash19 (made using OT-810) with 7.5 cm STUK 37 pic3
vehiclecc-zero
USS Hornet (CV-12) patch - Oregon Air and Space Museum - Eugene, Oregon - DSC09800
self-published workpd us military
Fruits of Asclepias syriata used as decoration for their parrot looking, for sale on the market of Louhans (Saône-et-Loire, France).
apocynaceaeplants
சிறு புள்ளடி Botanical name - Desmodium triphlorum Common name - Three-flower beggarweed Rich in polyphenols ; Leaf poultice is applied on wounds ;Plant is used for nervous system stimula
plantspink
சிறு புள்ளடி Botanical name - Desmodium triphlorum Common name - Three-flower beggarweed Rich in polyphenols ; Leaf poultice is applied on wounds ;Plant is used for nervous system stimula
plantsleaves
Eggplants, Okra (Abelmoschus esculentus) fields in the Philippines, Basella alba, Alugbati vegetable Basella alba used in Utan, Vigna unguiculata subsp. sesquipedalis or Sitaw or string beans, Siling
eggplantplants
Notice how P-33 turns her head to the side while she bites through the deer hide? She is using her carnassial teeth, which are modified molars and premolars that act as shears to cut through the tough
animalsmammals
49th (West Riding) Infantry Division patch. Second pattern, embroidered felt, used.
animalsmammals
First Canyon on the Manti-La Sal National Forest. Photo by Corinne Dalton, September 28, 2011. Credit: US Forest Service.
animalsmammals
Photograph of Trichosanthes Cucumerina (aka Snake Gourd)
foodtree
Great Black-backed Gull Larus marinus at Sandy Point State Reservation, Ipswich US-MA.
animalsbird
A Delmarva Peninsula fox squirrel in a fabric cone that is used to handle the captured animals during a fox squirrel population survey. Credit: USFWS/Ryan Hagerty
animalsmammals
Wilson's phalarope at Mills Lake in Northwest Territories. You are free to use this photo with the following credit: Joseph Sands, USFWS
animalsbird
Arreglo con flor de cempasúchitl en el Jardín Borda; Cuernavaca, Morelos.
asteraceaeplants
Cruz, lago y camino de flor en Jardín Borda
autumnplants
Salaria pavo (Risso, 1810). Peacock blenny male. This funny predatory fish was caught in the Black sea. Wet matter was used as a background to prevent damage to its skin. After very short photosession
osteichthyesblenniidae
Музей военной техники "Оружие Победы". Парк культуры и отдыха имени 30-летия Победы, Краснодар. The Russian Museum Law, article 36, restricts anyone from: using images of museum objects and coll
torpedoes of the soviet unionkrasnodar
US Navy 020615-N-6492H-503 F-14
aboard uss john f. kennedy (cv-67)vehicle
US Navy 021024-N-4374S-048 VQ-1 conducts missions in the Middle East
militaryvehicle
US Navy 021205-N-1810F-012 giving the signal indicating the holdback bar is secured
militaryaircraft
US Navy 021121-N-0000X-006 he Aries ballistic missile target is seen through the infrared seeker of the developmental Standard Missile-3 (SM-3) Kinetic Warhead moments before intercept
pacific missile range facility (barking sands)aries (rocket)
US Navy 021213-N-6895M-505 Aviation Ordnancemen secure ordnance to the wing of an F-A-18 Hornet from Carrier Air Wing Eight (CVW-8) on the ship's flight deck
aviation ordnancemannavy
US Navy 021209-O-0000X-003 Spanish Sailors aboard the Santa Maria-class Frigate Navarra (F-85) man provide cover for boarding teams, during a hostile boarding of the North Korean vessel, So San
piracy in somaliasps navarra (f85)
US Navy 030114-N-5786V-002 Phalanx MK-15 Close In Weapons Systems (CIWS) fires a high-speed computer controlled, radar guided, 20 mm Gatling gun
uss theodore roosevelt (cvn-71) flight deckphalanx ciws firing
US Navy 030321-N-6895M-505 Flight deck personnel stand at the ready while an S-3B Viking assigned to the
s-3b vikingpeople
US Navy 030323-N-4048T-046 Deck Department personnel observe the night launch of a Rigid Hull Inflatable Boat (RHIB) aboard the amphibious assault ship USS Kearsarge (LHD 3
aboard uss kearsarge (lhd-3)rigid-hull inflatable boat
US Navy 050113-N-6363M-024 A Sailor assigned to the Air Department aboard USS Harry S. Truman (CVN 75) inspects one of the four steam-powered catapults prior to the commencement of flight operations
aboard uss harry s. truman (cvn-75)
US Navy 050211-N-0357S-046 Hospital Corpsmen aboard the Military Sealift Command (MSC) hospital ship USNS Mercy (T-AH 19), prepare to take an elderly Indonesian man down the ship's elevator
aboard usns mercy (t-ah-19)
US Navy 050216-N-0962S-154 Master Chief Petty Officer of the Navy (MCPON) Terry Scott testifies before the House Appropriations Committee, subcommittee on Military Quality of Life and Veteran's Affairs
people of the united states department of veterans affairsterry d. scott
US Navy 050309-N-8704K-001 Aviation Boatswain's Mate 1st Class Robert McCray signals that the number one catapult is ready to launch a T-45A Goshawk
aboard uss john f. kennedy (cv-67)mcdonnell douglas t-45 goshawk
US Navy 050425-N-4729H-202 Commander, Navy Recruiting Command, Rear Adm. Jeffrey Fowler, discusses weather patterns with student Ervin Hall at the Math, Civics and Science Charter School
united states navy images from philadelphiapeople
US Navy 050406-N-0000J-001 The Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75) sits at anchor in Stokes Bay on the south coast of England during a scheduled port visit
militaryvehicle
US Navy 050408-N-0357S-021 Air Department personnel await the start of vertical replenishment operations on the flight deck aboard the Military Sealift Command (MSC) hospital ship USNS Mercy (T-AH 19)
aboard usns mercy (t-ah-19)
US Navy 050418-G-3948H-001 he Norwegian Dawn cruise ship pulls into the New York Harbor
vehiclewater
US Navy 050418-N-8704K-001 The conventionally powered aircraft carrier USS John F. Kennedy (CV 67), conducts a Close-in Weapons System (CWIS) live fire test
aboard uss john f. kennedy (cv-67)phalanx ciws firing
US Navy 050427-N-0357S-009 Hospital Corpsman 2nd Class Cyrena Williams teaches a class on infectious disease to students at a school on the island of Nias
celebritiesgroup
US Navy 050527-N-6477M-209 Seaman Christopher A. Racca, assigned to the Nimitz-class aircraft carrier USS Abraham Lincoln (CVN 72), places an American flag at the headstone of a veteran
washingtonlawn
US Navy 030408-N-0728B-002 U.S. Navy Chaplain, Lt. Cmdr. John Denton visits with U.S. Marine Corps. Cpl. Marco Chavez while in the casualty receiving area of Fleet Hospital Three
militaryarmy
US Navy 030418-N-2385R-007 An E-2C
uss nimitz (cvn-68) flight deckvehicle
US Navy 030530-N-3228G-001 Boatswain's Mate 2nd Class Michael J. Fisk snaps the plastic window panels into place
admiral's bargesboat
US Navy 030513-N-5319A-002 Plebes participate in an 11.5 hour rigorous physical and mental challenges at the United States Naval Academy
people lifting logssea trials
US Navy 030620-N-0413R-002 Aviation Machinist's Mate 3rd Class Elisabeth Medlin installs an engine in an F-A-18F Super Hornet in the Hanger Bay aboard USS Nimitz (CVN-68)
aboard uss nimitz (cvn-68)general electric f414
US Navy 030825-F-2828D-352 Secretary of Defense Donald H. Rumsfeld responds to a reporter's question during a press conference at Lackland Air Force Base, San Antonio
press conferences in the united statesdonald rumsfeld in 2003
US Navy 031006-F-2828D-098 Secretary of Defense Donald H. Rumsfeld and Air Force General Ralph Ederhart, Commander, United States Northern Command, talk with senior military leadership
celebritiesgroup
US Navy 030907-N-2143T-003 Aviation Ordnanceman 3rd Class Josh Dodive, from Jacksonville, Fla., unscrews a side panel off an aircraft in the hanger bay aboard USS Nimitz (CVN 68)
aboard uss nimitz (cvn-68)aviation ordnanceman
US Navy 030722-N-9319H-010 Airman Darrell White from Birmingham, Al., fuels an F-A-18E Super Hornet prior to flight operations on the flight deck of USS Nimitz (CVN 68)
militaryarmy
US Navy 030828-N-2143T-002 Various Navy aircraft are chocked and chained to the flight deck, as the guided missile cruiser USS Princeton (CG-59) steams forward of USS Nimitz (CVN 68)
vehiclenavy
US Navy 051006-N-3019M-011 Sailors assigned to the guided missile frigate USS Reuben James (FFG 57), plug a leaking bulkhead during the Damage Control Olympics
aboard uss reuben james (ffg-57)damage control
US Navy 051006-N-3019M-003 Damage Controlman Fireman Jason Robinson, assigned to the guided missile destroyer USS Paul Hamilton (DDG 60), opens the nozzle on a fire hose
uss paul hamilton (ddg-60)damage controlman
US Navy 051130-N-0295M-001 Chief of Naval Operations Mike Mullen applauds the U.S. Naval Academy cheerleaders and their mascot Bill the Goat during a Pep-Rally at the Pentagon
people of the united states navycelebrities
US Navy 051105-N-9693M-009 ) U.S. Naval Academy Midshipman 1st Class Marco Nelson (29) crosses the goal line to score in the 1st quarter of play
sport2005
US Navy 060128-N-2568S-003 Secretary of the Navy (SECNAV) Dr. Donald C. Winter receives a briefing from Lt. Col. Chris Wagner on the personal protective gear worn by Marines operating in Iraqi
donald c. winter in 2006al taqaddum airbase
US Navy 060117-N-9866B-363 Aviation Ordnanceman 3rd Class Carlos Pizana fires a 50 cal. machine gun during a familiarization fire
aviation ordnancemanshoot
US Navy 060117-N-3019M-003 U.S. Army UH-60 Blackhawk helicopters prepare to take off from Fleet Industrial and Supply Center
militaryvehicle
US Navy 030322-N-2410G-507 An EA-6B Prowler assigned to the
aircraftvehicle
US Coast Guard Maritime Safety and Security Team (MSST) 91114 patrols the coastline of Guantanamo Bay DVIDS358658
vehiclewater
US Coast Guard Maritime Safety and Security Team (MSST) 91114 patrols the coastline of Guantanamo Bay DVIDS358656
vehiclewater
US carriers at Alameda 1974
monochromevehicle
US Navy 020329-N-3995K-108 Recruit studies the Bluejacket's Manual
great lakesillinois
US Navy 050527-N-3390M-025 Personnelman Seaman Keith Williams-Bey, assigned to the guided missile frigate USS Ford (FFG 54), sings the National Anthem
national anthems ceremoniesnaval station everett
US Navy 050712-N-0962S-136 Three of the Navy's top Command Master Chiefs (CMCs) observe an all hands call by Master Chief Petty Officer of the Navy (MCPON) Terry Scott
terry d. scottgroup
US Navy 050621-N-9866B-017 A Landing Craft, Air Cushion (LCAC), assigned to Assault Craft Unit Five (ACU-5), makes its way through the Pacific Ocean
vehicle1994
32701 - 32800 of 109,879 Next page
/ 1099