1,235 Free Images of Osprey

mv-22b ospreyaboard uss america (lha-6)vehiclenavymilitaryaircraftcrew of uss america (lha-6)flybirdflight
COMREL at Albert Schweitzer Municipal School 140806-N-LQ799-277
crew of uss america (lha-6)mv-22b osprey
COMREL at Albert Schweitzer Municipal School 140806-N-LQ799-041
crew of uss america (lha-6)mv-22b osprey
Soccer match with Brazilian navy 140806-N-MD297-285
mv-22b ospreysport
Airfield Operations in Support of Operation Unified Response DVIDS244714
naval station guantanamo baymv-22b osprey
Brazilian VIPs tour USS America 140804-N-CC789-060
aboard uss america (lha-6)mv-22b osprey
Brazilian VIPs tour USS America 140804-N-CC789-026
aboard uss america (lha-6)mv-22b osprey
COMREL at Albert Schweitzer Municipal School 140806-N-LQ799-272
crew of uss america (lha-6)mv-22b osprey
Soccer match with Brazilian navy 140806-N-MD297-166
mv-22b ospreyfield
Soccer match with Brazilian navy 140806-N-MD297-552
mv-22b ospreygroup
Soccer match with Brazilian navy 140806-N-MD297-475
mv-22b ospreygroup
Soccer match with Brazilian navy 140806-N-MD297-524
mv-22b ospreysport
USS America tiger cruise 141014-N-MD297-008
uss america (lha-6) flight deckmv-22b osprey
USS America press conference 140831-N-CC789-359
mv-22b ospreypeople
PHIBLEX 15 141003-N-UD469-045
31st marine expeditionary unitmv-22b osprey
USS Mesa Verde firefighting exercise 140220-N-BD629-105
uss mesa verde (lpd-19)mv-22b osprey
USS America activity 140821-N-MD297-040
mv-22b ospreyvehicle
US Navy 090701-N-3165S-134 An MV-22B Osprey from Marine Medium Tiltrotor Squadron 263 (VMM 263) (Reinforced), 22nd Marine Expeditionary Unit, takes off from the flight deck of multi-purpose amphibious assault ship USS Bataan (L
militaryvehicle
US Navy 070814-N-8154G-114 A U.S. Air Force CV-22 Osprey, assigned to the 8th Special Operations Squadron (8th SOS), performs a fly-by of amphibious assault ship USS Bataan (LHD 5) during deck landing qualifications (DLQs)
militaryvehicle
USS Bonhomme Richard conducts flight operations. (13588785165)
militaryvehicle
US Navy 100415-N-2147L-001 Marines assigned to India Company, 3rd Battalion, 9th Marine Regiment board an MV-22 Osprey aboard the amphibious transport dock ship USS New York (LPD 21)
mv-22b osprey on flight decksnavy
Bell-Boeing CMV-22B Osprey hovers at Amarillo, Texas (USA), on 7 February 2020 (200202-N-QO990-1004)
militaryvehicle
At NASA's Kennedy Space Center in Florida, an adult osprey guards its young in a nest built on a platform in the Press Site parking lot. In the background is the 12,300-square-foot NASA logo painted o
animalsbird
Crew prepares for Rio departure 140809-N-YB590-109
mv-22b ospreynavy
Crew prepares for Rio departure 140809-N-YB590-139
mv-22b ospreypeople
Airfield Operation in Support of Operation Unified Response DVIDS244708
naval station guantanamo baymv-22b osprey
An MV-22 does a touch-and-go aboard USS Carl Vinson. (8497230845)
bell-boeing v-22 osprey (usmc)sunset
Brazilian VIPs tour USS America 140804-N-LD343-014
aboard uss america (lha-6)mv-22b osprey
Bataan Amphibious Ready Group, 2014 Deployment 140502-N-IK431-048
22nd marine expeditionary unitmv-22b osprey
USS Bonhomme Richard 140419-N-LM312-019
mv-22b ospreyvehicle
USS America operations 140824-N-EV723-030
aboard uss america (lha-6)mv-22b osprey
USS America tiger cruise 141015-N-MD297-056
mv-22b ospreypeople
US Navy 120131-N-NR955-119 An Osprey helicopter lands on the flight deck
aboard uss gunston hall (lsd-44)
USS America operations 141003-N-MD297-134
mv-22b ospreyfly
Women's Equality Day observance 140822-N-MD297-026
mv-22b ospreylight
Women's Equality Day observance 140822-N-MD297-054
mv-22b ospreygroup
Australia bird wildlife
birdtree
Osprey bird raptor
naturebird
US Navy 070629-N-5588M-009 Chief Aviation Boatswain's Mate Handler Ricardo Zaldana, observes the landing of an MV-22 Osprey aboard the amphibious assault ship USS Nassau (LHA 4)
militaryvehicle
US Navy 091106-N-8132M-120 An MV-22B Osprey from Marine Medium Tiltrotor Squadron 263 (Reinforced), 22nd Marine Expeditionary Unit, takes off from the amphibious assault ship USS Bataan (LHD 5)
militaryaircraft
US Navy 100124-N-7456N-034 An MV-22 Osprey assigned to the Golden Eagles of Marine Medium Tiltrotor Squadron (VMM) 162, is on the tarmac at Naval Station Guantanamo Bay
militaryvehicle
US Navy 091002-N-3165S-089 Sailors aboard the multi-purpose amphibious assault ship USS Bataan (LHD 5) and embarked Marines from the 22nd Marine Expeditionary Unit (22nd MEU) move an MV-22B Osprey
vehiclenavy
USS America operations 140831-N-LD343-006
mv-22b ospreyvehicle
USS America tour 140824-N-CC789-194
mh-60s seahawkmv-22b osprey
USS Arizona survivor visits USS America 141023-N-LQ799-085
aboard uss america (lha-6)mv-22b osprey
USS America operations 140723-N-LQ799-051
militarynavy
Soccer match with Brazilian navy 140806-N-MD297-345
sportgame
Chilean distinguished visitors aboard USS America 140823-N-MZ309-058
aboard uss america (lha-6)mv-22b osprey
Chilean distinguished visitors aboard USS America 140823-N-MZ309-069
aboard uss america (lha-6)mv-22b osprey
CWIS maintenance 141005-N-MD297-013
uss america (lha-6)mv-22b osprey
Bright Star DVIDS217571
vehiclenavy
Brazil distinguished visitors aboard USS America 140805-N-MZ309-030
aboard uss america (lha-6)mv-22b osprey
Ice Cream Social 141014-N-MD297-093
ice cream socialmv-22b osprey
COMREL at US Municipal School 140808-N-AC979-088
indooryoung
Soccer match with Brazilian navy 140806-N-MD297-300
grasssport
PHIBLEX 15 141003-N-UD469-055
aircraftvehicle
USS America reception 140807-N-EV723-101
aircraftvehicle
USS Arizona survivor visits USS America 141023-N-LQ799-184
aboard uss america (lha-6)mv-22b osprey
USS America visit 140719-N-YB590-049
militaryarmy
Wildlife flight raptor
naturebird
Perches an osprey
animalsbird
USS America press conference 140831-N-CC789-251
militarynavy
USS America operations 141003-N-MD297-088
mv-22b ospreyvehicle
An Osprey (Pandion haliaetus) with a fist full of sushi. Photo taken with an Olympus E-P1 in the Merritt Island National Wildlife Refuge, FL, USA.Cropping and post-processing performed with The GIMP.
animalsbird
US Navy 090529-N-9740S-313 An MV-22B Osprey assigned to Marine Medium Tiltrotor Squadron (VMM) 263 (Reinforced) is secured on the flight deck of the multi-purpose amphibious assault ship USS Bataan (LHD 5)
night shotnight
Osprey near Tagnum Beach Nelson, British Columbia, Canada
animalsbird
Peleliu conducts flight operations 141123-N-LQ926-269
vehiclesea
Brazil distinguished visitors aboard USS America 140805-N-MZ309-015
aboard uss america (lha-6)mv-22b osprey
Brazil distinguished visitors aboard USS America 140805-N-MZ309-022
aboard uss america (lha-6)mv-22b osprey
Chilean distinguished visitors aboard USS America 140823-N-FR671-021
aboard uss america (lha-6)mv-22b osprey
USS America operations 141003-N-MD297-084
mv-22b ospreyvehicle
USS Anchorage commissioning 130423-N-DR144-716
mv-22b ospreyvehicle
SNOOPIE team training evolution 140912-N-FR671-013
militarynavy
US Navy 080708-N-4014G-063 A V-22 Osprey aircraft from the
aboard uss bataan (lhd-5)vehicle
Venezuela raptor animal
animalsnature
Bird of prey tiwer africa
animalsbird
US Navy 101018-N-7508R-072 Aviation Boatswain's Mate Airman (Handling) Kelley Matthew and Aviation Boatswain's Mate Airman Justin Casey, from Brade
aircraftflight
US Navy 100126-N-6247V-171 A U.S. Customs and Border Patrol helicopter awaits passengers as a Navy MV-22 Osprey tilt-rotor aircraft lands in the background near the U.S. Embassy in Port-au-Prince, Haiti
aircraftvehicle
Hawk
animalsbird
Birds close-up florida
naturebird
USNS John Ericsson activity 150131-N-CU914-009
11th marine expeditionary unitmv-22b osprey
USS America tour 140824-N-FR671-143
mv-22b ospreypeople
COMREL at Albert Schweitzer Municipal School 140806-N-LQ799-138
celebritiesgroup
Real Thaw 2017 IMG 5750a (33223538332)
aircraftvehicle
Chilean distinguished visitors aboard USS America 140823-N-MZ309-244
mv-22b ospreypeople
Chilean distinguished visitors aboard USS America 140823-N-LD343-006
mv-22b ospreycelebrities
US Navy 091009-N-9740S-018 Sailors assigned to the multi-purpose amphibious assault ship USS Bataan (LHD 5) and embarked Marines from the 22nd Marine Expeditionary Unit (22nd MEU) move an MV-22B Osprey on the ship's flight deck
mv-22b osprey on flight decksvehicle
US Navy 100617-N-3358S-042 An MV-22B Osprey assigned to the Golden Eagles of Marine Medium Tiltrotor Squadron (VMM) 162 lands aboard the amphibious transport dock ship USS Mesa Verde (LPD 19)
militarynavy
Image title: Osprey insect nest Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-domain-images-pictures/insects-and-bugs-public-domain-images
animalsbird
Usmc air helicopter
militaryvehicle
An MV-22 does a touch-and-go aboard USS Carl Vinson. (8497231265)
vehicleseaside
Brazilian naval officers and marines aboard USS America 140802-N-MD297-028
aboard uss america (lha-6)mv-22b osprey
Ice Cream Social 141014-N-MD297-045
mv-22b ospreybowl
CERTEX 130811-N-KL846-009
navysea
RIMPAC 140617-N-YW024-128
militaryvehicle
USS America activity 140721-N-CC789-037
naval station guantanamo baymv-22b osprey
Talisman Sabre 2015 150717-N-TW634-142
31st marine expeditionary unitmv-22b osprey
USS Arizona survivor visits USS America 141023-N-LQ799-079
mv-22b ospreypeople
USS Mesa Verde 140529-N-BD629-087
22nd marine expeditionary unitmv-22b osprey
USS America activity 140721-N-CC789-021
naval station guantanamo baymv-22b osprey
USS America operations 140819-N-LQ799-104
vehiclesea
301 - 400 of 1,235 Next page
/ 13