99,003 Free Images of Navy

vehicleimages from united states navy to checkaircraftshipmilitaryaviationjetgroupair forcewater
US Navy 061216-N-0773H-081 Musician 1st Class Michael A. Webb of the Sea Chanter
dar constitution halld.c.,
US Navy 070202-N-8110K-011 Guided missile destroyer USS Mahan (DDG 72) prepares to dock in Boston for a port visit
boatship
US Navy 110421-F-CF975-145 Aviation Electrician's Mate Airman Joshua Schell, from Baltimore, talks to neighborhood children during a Continuing Pro
architecturejamaica
US Navy 110426-N-OT964-090 Navy Divers 2nd Class Troy Crowder, left, and Cody Creger test the voice communications inside of Kirby Morgan 37 diving
united states navy images from mina salmankirby morgan 37 diving helmet
US Navy 110520-N-VQ827-634 The guided-missile destroyer USS Truxtun (DDG 103) is underway during the Royal Navy-sponsored joint exercise Saxon Warr
boatsea
US Navy 110520-N-1004S-798 An EA-6B Prowler assigned to the Cougars of Tactical Electronic Warfare Squadron (VAQ) 139 lands aboard the aircraft car
electronic attack squadron 139 (united states navy)vehicle
US Navy 110605-F-ET173-189 Cmdr. Raymond Houk, a Navy chaplain embarked aboard the Military Sealift Command hospital ship USNS Comfort (T-AH 20), w
aboard usns comfort (t-ah-20)urban
US Navy 110606-N-AD372-012 Master Chief Petty Officer of the Navy (MCPON) Rick D. West takes questions from Chief Builder Charles Reed during an al
rick d. westtexas
US Navy 110323-N-AE328-006 Cmdr. Manuel Biadog, Jr., Naval Base Kitsap command chaplain, helps a military spouse contact local family members after
united states navy chaplainspeople
US Navy 110323-N-HI707-036 Lt. Cmdr. Dwight Isaacs, the exercise planning officer for the multi-national training exercise Obangame Express 2011, s
africa partnership station 2011obangame express
US Navy 110323-N-AE328-002 Cmdr. Manuel Biadog, Jr., Naval Base Kitsap command chaplain, entertains a child while his mother waits for her luggage
united states navy chaplainsgroup
US Navy 110811-N-CI293-119 Rear Adm. Mark D. Guadagnini, deputy commander for Fleet Management and chief of staff for U.S. Fleet Forces Command,
fargo navy weeknorth dakota
US Navy 110509-N-TY225-156 A CH-53 Sea Stallion helicopter assigned to Helicopter Mine Countermeasures Squadron (HM) 15 conducts an airborne mine c
helicopter mine countermeasures squadron 15 (united states navy)united states navy in the persian gulf
US Navy 110511-N-ZZ000-001 Cmdr. Monica Allen, a Navy combat artist specializing in watercolor, works on a new painting while deployed to Naval Air
naval air station sigonella in the 2010swomen in the united states navy
US Navy 110511-N-TY225-146 Explosive ordnance disposal technicians and Navy divers assigned to Commander, Task Group 56.1 train using the MK-16 clo
sportgame
Lockheed OP-2E Neptune of VO-67 in flight on a mission over Laos, circa in 1967
militaryvehicle
US Navy 061114-N-0780F-001 U.S. Navy Chaplain Lt. Douglas Bryan from the guided-missile cruiser USS Philippine Sea (CG-58) reaches to apply some finishing touches to the chapel at the Chania Senior Citizen's Home during a commu
aboard uss philippine sea (cg-58)united states navy chaplains
US Navy 100310-N-7948C-183 Ghana sailors work with Sailors aboard the amphibious dock landing ship USS Gunston Hall (LSD 44) to moor the ship for the first African port visit of Africa Partnership Station (APS) West 2010
waternavy
US Navy 080625-N-1424C-001 The Military Sealift Command heavy lift ship SS Cape Mohican (T-AKR 5065) carries Navy Lighterage, Landing Craft Air Cushion (LCAC), and Navy Roll-on Roll-off Discharge Facility (RRDF)
waternavy
US Navy 110626-N-AE328-098 U.S. Navy Band Northwest performs at the 20th annual International Military Band Concert at the Bremerton Performing Art
washingtonpeople
US Navy 030531-N-0000X-001 An F-14D Tomcat assigned to the
militaryvehicle
US Navy 020812-N-8677R-002 patient receives Navy ballcap
boys wearing hatspeople
US Navy 070811-N-3093M-020 Chief Navy Diver Scott Maynard attached to Mobile Diving and Salvage Unit (MDSU) 2, readies for a dive into the Mississippi river in support of ongoing search and recovery operations
underwater video equipmentdive light
US Navy 050909-N-9769P-066 The pit crew of the No. 14 Navy Dodge Charger from the Navy-FitzBradshaw NASCAR Busch Series team make adjustments to the racecar
vehiclecar
US Navy 110727-N-WP746-410 U.S. Navy Sailors with ties to the Filipino community welcome the Philippine navy frigate BRP Gregorio del Pilar (PF-15
united states navy images from pearl harborpeople at pearl harbor
US Navy 060908-N-3271W-002 Members of the U.S. Navy Parachute Demonstration Team Leap Frogs land in the Clearfield High School football field prior the school's season opener
united states navy parachute teamclearfield high school
US Navy 060420-N-2568S-107 U.S. Navy Seabee, Lt. Cuadros, explains to the Secretary of the Navy (SECNAV) the Honorable, Dr. Donald C. Winter the work his Seabees are doing in Djibouti
united states navy images from djiboutidonald c. winter in 2006
US Navy 101108-N-8546L-677 Master-at-Arms 1st Class Jonathan Upton, left, a U.S. Navy military working dog handler from Jacksonville, Ala
master-at-armsuruguay
US Navy 071012-N-8704K-134 Navy birthday celebration aboard USNS Comfort
gary roughead in 2007cake cut
US Navy 071023-N-2653P-493 Rep. Timothy H. Bishop delivers his remarks during a Medal of Honor Flag ceremony recognizing the actions of Navy SEAL Lt. Michael Murphy held at the United States Navy Memorial
people at the united states navy memorial
US Navy 090629-A-1839I-089 Members of the Navy of the Argentine Republic naval infantry practice room-clearing procedures in Puerto Belgrano during a training session with U.S. Marines
puerto belgranoroom clearing
US Navy 080211-N-0773H-077 Commanding Officer-leader of the United States Navy Band, Capt. George N. Thompson, leads the audience in the
united states navy bandmaryland
US Navy 050624-N-8861F-001 U.S. Navy Diver Chief Electrician's Mate Mike Welsh helps Russian Navy Diver Igor Zhiazhivov check his gear before the dive aboard the salvage ship USS Grasp (ARS 51)
tarantopeople
US Navy 071110-N-8053S-248 Navy Midshipmen running back, Zerbin Singleton, is tackled by University of North Texas (UNT) defense during the Navy vs. UNT football game
navy midshipmen football gamestackle (american football)
Pirate ship boat pirates
waterflag
2ndEarlOfMinto, Francis Grant, 1851
people of the georgian eraearls of minto
Flickr - Official U.S. Navy Imagery - A U.S. Navy officer swims the 50-meter freestyle during a Rim of the Pacific Exercise.
water sportsport
Flickr - Official U.S. Navy Imagery - CO's fly above USS Enterprise.
carrier airborne early warning squadron 123 (united states navy)images from united states navy to check
Flickr - Official U.S. Navy Imagery - Four Navy ships underway at sunrise.
sunsetlight
Flickr - Official U.S. Navy Imagery - Chief of Naval Operations (CNO) Adm. Jonathan Greenert speaks at the Navy-Marine Corps Relief Society Ball.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Navy ships are anchored in the waters of Joint Base Pearl Harbor-Hickam
travelwater
Flickr - Official U.S. Navy Imagery - Prowler launches from USS John C. Stennis
electronic attack squadron 133 (united states navy)images from united states navy to check
US Navy 110805-N-KV696-026 Joint Chiefs of Staff Adm. Mike Mullen introduces President Barack Obama during his visit to the Washington Navy Yard
washington navy yard
US Navy 060820-N-9076B-249 Navy Lt. Cmdr. Helen Chun, of San Diego, checks to see if a local woman has tremors
united states navy images from kupang
US Navy 101211-N-3857R-005 U.S. Naval Academy fullback Alexander Teich celebrates with fellow midshipmen after the 111th annual Army-Navy football
2010 army-navy game
U.S. Navy Seabees Building New Schools In Espirtu Santo 110418-N-KB563-107
united states navy seabeespacific partnership 2011
US Navy 100719-N-4930E-310 Navy Reserve Sailor of the Year Hospital Corpsman 1st Class Shalanda Brewer inspects new uniform shoes at the Navy Annex
arlington countyvirginia
US Navy 061013-F-3500C-447 View over the U.S. Navy Annex, showing the completed U.S. Air Force memorial
virginiavillage
US Navy 111218-N-AC887-347 Secretary of the Navy addresses Sailors and Marines during an all-hands call
peoplearmy
US Navy 120103-N-ZI635-691 A helicopter retrieves supplies
vehiclenavy
US Navy 110629-N-AD372-091 Master Chief Petty Officer of the Navy (MCPON) Rick D. West speaks at the Navy Counselors Association Conference
dallastexas
US Navy 110629-N-VY256-066 A U.S. Navy and an Armed Forces of the Philippines Navy sailor replace a basketball goal during a community service proj
aboard chung-hoon (ddg-93)
US Navy 110518-N-ZB612-047 Sailors of the U.S. Navy Ceremonial Guard participate in the welcoming ceremony for Staff Brig. Gen. Ibrahim Salim Al Mu
u.s. navy museumarmy
US Navy 110603-N-ZB612-190 More than 200 Sailors and Marines attend a wreath laying ceremony at the Navy Memorial to commemorate the 69th anniversa
united states navy memorialcity
US Navy 110608-N-KB666-232 Navy Diver 1st Class Jimmy Sotelo instructs foreign divers on sub-surface search techniques
united states navy images from bridgetown
Flickr - Official U.S. Navy Imagery - USS Vicksburg leads other U.S. Navy ships into formation while transiting the Atlantic Ocean.
shipsea
Flickr - Official U.S. Navy Imagery - Sailors remove the chocks and chains from a helicopter.
helicopter sea combat squadron 21 (united states navy)images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailors volunteer at a community service event. (2)
celebritiespeople
Flickr - Official U.S. Navy Imagery - T-6B Texan II training aircraft are staged on the tarmac.
list of united states navy aircraft squadronsimages from united states navy to check
Flickr - Official U.S. Navy Imagery - U.S. and Panamanian divers work on a salvage project in Navy Dive-Southern Partnership Station 2012.
waterboat
Demonstration for Cheyenne Navy Week 150718-N-JY507-079
peoplegroup
Planes
militaryvehicle
The Shuttle Enterprise With Star Trek Cast
aircraftvehicle
Airplanes
militaryvehicle
untitled
militaryvehicle
Gdask, Poland, War
boatship
Hamburg, Velgnne, Germany
boatship
Jaqueline Rodriguez 2011 (cropped)
sailors from the united states navypepper spray
Flickr - Official U.S. Navy Imagery - A Sailor clears a launching area after launch.
vehiclenavy
Flickr - Official U.S. Navy Imagery - A Sailor directs a Landing Craft Air Cushion.
vehiclelav-25
Flickr - Official U.S. Navy Imagery - F-A-18 launches from flight deck.
militaryvehicle
Flickr - Official U.S. Navy Imagery - USS John C. Stennis (CVN 74) launches a bird.
militaryvehicle
US Navy 061130-N-3642E-152 Secretary of the Navy (SECNAV) The Honorable Dr. Donald C. Winter shows his confidence that the U.S. Army will once again make the U.S. Navy football team look good
donald c. winter in 2006thumbs up
US Navy 060120-N-2568S-219 Secretary of the Navy (SECNAV) the Honorable Dr. Donald C. Winter announces the naming of the next Lewis and Clark-class ship
portsmouth naval shipyarddonald c. winter in 2006
US Navy 060126-F-2902B-192 The U.S. Ambassador to Kenya, William Bellamy, shows his appreciation for the U.S. Navy Seabees' hard work after a memorial ceremony for those killed in a building that collapsed
united states navy in nairobipeople
US Navy 091022-N-3038W-822 Two MH-60S Sea Hawk helicopters
militaryaircraft
US Navy 090220-N-4774B-057 Helicopter pilot Lt. j.g. Gabrielle Scarlata entertains children at the Kuda Kudhin ge Hiya neglected children's home in Villingili
project handclasp (united states navy)maldives
US Navy 090306-N-7130B-210 Capt. Johngie Tison, and Lt. James Vandevoort destroy ordnance near Zamboanga City
joint special operations task force - philippinesunited states navy explosive ordnance disposal
US Navy 090313-N-8110K-029 The guided-missile destroyer USS Taylor (FFG 50) shares the pier with USS Constitution at the Charlestown Navy Yard
watership
US Navy 090622-N-5345W-061 Marines assigned to the 22nd Marine Expeditionary Unit (22nd MEU) run laps on the flight deck
22nd marine expeditionary unitpeople
US Navy 091120-N-2420K-189 Constructionman Benjamin Kistner, assigned to Naval Mobile Construction Battalion (NMCB) 3, uses a string line to square a foundation
united states navy images from moroniunited states navy seabees
US Navy 100316-N-5366K-011 Capt. Thomas Calabrese talks to 7th and 8th grade students about submarines at Academy Prep Center of Tampa during Tampa Bay Navy Week
uss florida (ssgn-728)group
US Navy 070308-N-4163T-328 Two members of the U.S. Navy Parachute Demonstration Team Leap Frogs land in San Diego's Qualcomm Stadium as part of a training session
united states navy parachute teamparachute landing
US Navy 070321-F-0524H-151 Chaplain (Cmdr.) W.M. Sonny Dinkins talks with a nun from the Sisters of Charity Baby Clinic in Antananarivo during a trip to meet with area religious leaders
united states navy chaplainsnun
US Navy 070930-F-9074R-014 A group observes the work done by a U.S. Navy Mobile Construction Battalion during a tour of the Combined Joint Task Force-Horn of Africa project
united states navy images from seychellesla digue
US Navy 101025-N-6770T-147 Royal Cambodian Navy Rear Adm. Ros Veasna, right, welcomes U.S. Navy Capt. David Welch, left, commander of Task Group 73
aboard uss crommelin (ffg-37)david a. welch
US Navy 110831-N-AD372-070 Master Chief Petty Officer of the Navy (MCPON) Rick D. West leaves a 1st class petty officer leadership symposium
celebritiesgroup
US Navy 110908-N-YZ751-001 Gas Turbine System Technician (Electrical) 3rd Class Bridgett J. Clark takes the E-5 Navy-wide advancement exam aboard U
aboard uss truxtun (ddg-103)navy-wide advancement exam
US Navy 110519-N-VA590-271 U.S. and Royal Thai Navy sailors perform a cheer during a soccer match at Nong Prue Municipality Sports Field
royal thai navysports day
US Navy 110520-N-1004S-479 Sailors clean the cockpit shield of an EA-6B Prowler aboard the aircraft carrier Ronald Reagan (CVN 76)
electronic attack squadron 139 (united states navy)aircraft cleaning
US Navy 100415-N-8273J-043 Chief of Naval Operations (CNO) Adm. Gary Roughead meets with Indian navy Vice Adm. K.N. Sushil
gary roughead in 2010kerala
US Navy 100419-N-2389S-043 Lt. Chris Yost, a pilot assigned to Helicopter Maritime Strike Squadron (HSM) 71, discusses helicopters
helicopter maritime strike squadron 71 (united states navy)united states navy images from des moines
US Navy 100506-N-8959T-103 Lt. Timothy Shanley, operations officer aboard the Arleigh Burke-class guided-missile destroyer USS Farragut (DDG 99), welcomes aboard a group of Australian navy Sailors
aboard uss farragut (ddg-99)navy
US Navy 120131-N-SH953-105 Seaman William Gillaspie assists Master Chief Petty Officer of the Navy (MCPON) Rick D. West as he climbs down the main
vehiclewater
US Navy 100616-N-6538W-065 Builder 3rd Class Garrett O'Brien chisels out notches for a roof at a forward outpost in Kunduz, Afghanistan
builder (united states navy)united states navy
US Navy 100806-N-9520G-002 Visitors tour the Arleigh Burke-class guided-missile destroyer USS Kidd (DDG 100) during the 61st annual Seattle Seafair Navy Week
seattle seafair navy weekaboard uss kidd (ddg-100)
US Navy 100808-N-2888Q-002 Rear Adm. Patricia Wolfe talks to Sailors assigned to Navy Cargo Handling Battalion (NCHB) 4 at Fort Lee, Va
united states navy images from virginiafort lee (virginia)
US Navy 101213-N-7589W-043 A Peruvian lab technician, center, explains antibody testing procedures to Capt. John Sanders and Cmdr. Mark Becker
naval medical research center (us navy)southern partnership station 2010
US Navy 101227-N-2055M-606 Lt. Jeffreys Ross commits the ashes of a former service member to the ocean during a burial at sea
burial at sea ceremonies of the united states navyaboard uss carl vinson (cvn-70)
US Navy 101108-N-8546L-339 Master-at-Arms 1st Class Jonathan Upton, left, a U.S. Navy military working dog handler from Jacksonville, Ala
uruguaygroup
6701 - 6800 of 99,003 Next page
/ 991