90,656 Free Images of Ii

cc-zeropaintings in the national museum in krakówpages with mapsvehicleaircraftmilitaryaviationjetfiles uploaded by daderotdrawings and watercolours of the royal museums greenwich
Antoni Gramatyka - Portrait of Wife with Daughter Anna - MNK II-a-991 - National Museum Kraków
paintings in the national museum in krakówantoni gramatyka
David II Teniers - An Inn - KMSsp265 - Statens Museum for Kunst
flemish paintings in the statens museum for kunsttavern scenes by david teniers the younger
An English ship in a strong breeze RMG PW7030
drawings and watercolours of the royal museums greenwichprinting
An English ship in a quartering breeze RMG PW6968
drawings and watercolours of the royal museums greenwichprinting
An English ship with the wind abeam RMG PV5255
drawings and watercolours of the royal museums greenwichprinting
An English flagship becalmed saluting RMG PW7012
drawings and watercolours of the royal museums greenwichprinting
Abdicazione del re Carlo Alberto
storia d'italia by giuseppe pistellicharles albert of sardinia in art
The Entry into Jerusalem - Google Art Project
ms. ludwig ii 6 (getty museum) - armenian gospel bookminiatures of the triumphal entry into jerusalem
Voyage Southern and Antarctic Regions-2-1847-0313
a voyage of discovery and research in the southern and antarctic regionsvol. ii (1847)
Walter Moras - Winter II
20th-century landscape paintingswinter landscape paintings
Voyage à Rome, vol 2 - 037 - Lac de Genève
lake geneva in artvevey
Voyage Southern and Antarctic Regions-2-1847-0431
a voyage of discovery and research in the southern and antarctic regionsvol. ii (1847)
Tomizawa hanzaburō LCCN2008660786
japanese fine printspre-1915
Vasili Dmitrijevitš Polenov - Vanha mies - A II 1374 - Finnish National Gallery
portrait paintings in the finnish national gallerypaintings by vasiliy polenov
Valkyrie RMG PW1942
printing 1893
Studies of gunports RMG PW6695
printing gun ports
Tōshūsai Sharaku (1794) Nisei Ichikawa Monnosuke no Date no Yosaku 01
koi nyōbō somewake tazunamonnosuke ichikawa ii
Wenceslas Hollar - The Richard II diptych (State 2)
university of toronto wenceslas hollar digital collectionprints by wenzel hollar
Tröja från 1620-talet - Livrustkammaren - 21721
images from livrustkammarenmale clothing
Tröja utan ärmar - Livrustkammaren - 44311
images from livrustkammaren1600s fashion
Three ships before the wind RMG PW6927
drawings and watercolours of the royal museums greenwichprinting
Tales from Shakespere-2-1844-0137
timon of athens (lamb)tales from shakespere
Stanisław Bartus - Portrait of a Nobleman - MNK II-a-293 - National Museum Kraków
paintings in the national museum in krakówbadeni family
Stanisław Witkiewicz - Spring Mist - MNK II-a-408 - National Museum Kraków
paintings in the national museum in krakówstanisław witkiewicz (1851-1915)
Stanisław Bryniarski - Tombstone of Leszek the Black in the Dominican Church in Krakow - MNK II-a-516 - National Museum in Kraków
paintings in the national museum in kraków
Stanisław Fabijański - View of the Wiśnicz Castle from the Chapel's Side - MNK II-a-1135 - National Museum Kraków
paintings in the national museum in kraków
Stanisław Witkiewicz - In Front of the Porch - MNK II-a-405 - National Museum Kraków
paintings in the national museum in krakówstanisław witkiewicz (1851-1915)
Stammbaum Christi c1490 ubs G 0173 II
woodcuts in the universitätsbibliothek salzburg15th-century woodcuts
Tales from Shakespere-2-1844-0063
the comedy of errors (lamb)charles gray (illustrator)
Luftaufnahme - Nürnberg-West von Süden - US-AF - 1953
world war ii destructions in nurembergaerial photographs of nuremberg
Jacek Malczewski - Summer Landscape - MNK II-b-1610 - National Museum Kraków
paintings in the national museum in krakówpaintings by jacek malczewski
Stanisław Witkiewicz - Foehn Wind - MNK II-a-490 - National Museum Kraków
paintings in the national museum in krakówstanisław witkiewicz (1851-1915)
Jan Matejko - Castellan's Daughter (Copy) - MNK II-a-912 - National Museum Kraków
paintings in the national museum in krakówpaintings by jan matejko
Olga Boznańska - Flowers on a Terrace - MNK II-b-1501 - National Museum Kraków
paintings in the national museum in krakówpaintings by olga boznańska
Olga Boznańska - Landscape Motif - MNK II-b-1324 - National Museum Kraków
paintings in the national museum in krakówpaintings by olga boznańska
Aleksander Gierymski - Girl from Bronowice - MNK II-a-599 - National Museum Kraków
paintings in the national museum in krakówpaintings by aleksander gierymski
Jan Ciągliński - Smyrna (Bazaar) - MNK II-b-444 - National Museum Kraków
paintings in the national museum in krakówpaintings by jan ciągliński
Wilhelm Kotarbiński - Tomb of a Suicide - MNK II-b-539 - National Museum Kraków
paintings in the national museum in krakówpaintings by wilhelm kotarbiński
Jan Stanisławski - Plough-Land in Spring - MNK II-b-569 - National Museum Kraków
paintings in the national museum in krakówjan stanisławski
F-4N of VF-301 and RF-8G of VFP-306 at NAS Miramar 1978
aircraftvehicle
F-4B Phantom II of VF-142 approaches USS Constellation (CVA-64) on 14 August 1967 (NNAM.1996.253.7287)
militaryaircraft
Capsicum annuum var. longum in the Philippines Siling Haba (in Barangays Diliman I, and Diliman II, San Rafael, Bulacan Province surrounded by Paddy fields of Diliman I and Diliman II, San Rafael, Bu
springbird
Rehabilitation of Sapang Patay Bridge (San Isidro II, Paombong, Bulacan: Malolos-Paombong-Hagonoy-Calumpit Road) from San Isidro I & II Bridge, Paombong, Bulacan River; Sitios Tawiran, Pajo and Ma
naturespring
Rehabilitation of Sapang Patay Bridge (San Isidro II, Paombong, Bulacan: Malolos-Paombong-Hagonoy-Calumpit Road) from San Isidro I & II Bridge, Paombong, Bulacan River; Sitios Tawiran, Pajo and Ma
springtree
Rehabilitation of Sapang Patay Bridge (San Isidro II, Paombong, Bulacan: Malolos-Paombong-Hagonoy-Calumpit Road) from San Isidro I & II Bridge, Paombong, Bulacan River; Sitios Tawiran, Pajo and Ma
springplants
Rehabilitation of Sapang Patay Bridge (San Isidro II, Paombong, Bulacan: Malolos-Paombong-Hagonoy-Calumpit Road) from San Isidro I & II Bridge, Paombong, Bulacan River; Sitios Tawiran, Pajo and Ma
springplants
ROCN Hsiung Feng II & Hsiung Feng III Anti-Ship Missile Launchers Trailer and Truck Display at Zuoying Naval Base Ground Left Front View 20161112
self-published workcc-zero
US Navy 100514-N-0807W-084 Vice Adm. H. Denby Starling II, former commander of Navy Cyber Forces and Naval Network Warfare Command leads a salute with the official party as his flag is hauled down
celebritiesjr
Anreppen - Naturschutzgebiet Lippeniederung II – Anreppen - 4
grassfield
Kaiser Heinrich II, c. 1235, from Adam's Portal, Bamberg Cathedral, Germany, c. 1900, plaster replica - Adolphus Busch Hall - Harvard University - DSC05687
self-published workcc-pd-mark
Litovel district 003
landscapenature
F-35B Landing Tyndall AFB 2
militaryvehicle
Vessel, Egypt, Neqade I or early Neqade II period, ceramic, K 1 - Martin von Wagner Museum - Würzburg, Germany - DSC05393
self-published workbrown
Sofa for Marie-Antoinette's private sitting room at Versailles, Paris, 1779, designer Jacques Gondoin, maker Francois II Foliot, carver Pierre-Edme Babel, beech - California Palace of the Legion of Honor - DSC07733
interior designinterior
Monument aux Chasseurs ardennais au pont d'Yvoir
self-published workpages with maps
Heart-shaped flask owned by Archduke Ferdinand II, India, probably Gujarat, 1500s, Iberian mount c. 1580, tortoiseshell (Eremochlys imbricate), silver - Metropolitan Museum of Art - New York City - DSC06920
self-published worktortoiseshell
Switzerland air show zigermeet
militaryaircraft
F-35 fighter airplane
militaryvehicle
Выступление архиепископа Михаила (С.В.Донскова) на II ФПО РТ
self-published workcc-zero
Kö-Bogen II under construction, 2020-04-26 (1)
carpinus betulus hedges in düsseldorfcc-zero
127 Kerstlied II, Es ist ein Reis entsprungen, pagina 184 & 128 Kerstlied III Nu syt wellecome, pagina 185
kun je nog zingenzing dan mee
A Sailor Doesn’t Have to Prove He's a Man
history of the united states navyfemale blond hair in art
445th Flight Test Squadron YA-7D 67-14853
militaryvehicle
F-4B Phantoms of VF-22L1 at Los Alamitos 1970
aircraftvehicle
Paris -Musée national du Moyen-âge - Plaque de reliure - Couronnement d'Otton II et de Théophano - 001
medieval ivory in hôtel de cluny (paris)problem of two emperors
Pagevärja Wolfert - Livrustkammaren - 25330
images from livrustkammarenmetal
Riksbanér i siden, 1607 - Livrustkammaren - 108772
royal coats of arms of swedensilk
Sailors direct an AV-8B Harrier 120601-N-HF252-075
militaryvehicle
French heavy cruiser Tourville at Casablanca in late 1943
boatship
James II Portrait Medallion, 1767–1780 (CH 18177809)
product design and decorative arts in the cooper–hewittsmithsonian design museum
HMS Victorious (R38) at anchor at at Noumea, New Caledonia, in 1943
black and whitemonochrome
A-7E VA-15 with bombs 1976
militaryvehicle
A-7E VA-27 landing on CVN-70 1987
vehiclenavy
Genforeningsjubilæet 2021 (51251347496)
prince christian of denmark in 2021frederik
Genforeningsjubilæet 2021 (51252392635)
prince christian of denmark in 2021frederik
Kopparmynt, Spanien, 1691 - Skoklosters slott - 109774
coins of charles ii of spaincircle
Målning. Pieter Brueghel, Bondbröllop - Hallwylska museet - 86695
villagetravel
McDonnell Douglas RF-4C-37-MC Phantom 68-0555
militaryvehicle
USS Barrow (APA-61) arriving at Portland, Oregon (USA), circa in October 1945
boatship
World War II Memorial - Monterey Veterans Memorial Park - Monterey, MA - DSC07362
self-published workpd text
World War II bunker, Cape May Point State Park J
self-published workpages with maps
World War II bunker, Cape May Point State Park G
self-published workpages with maps
World War II bunker, Cape May Point State Park D
self-published workpages with maps
World War II service medals, 1942-1947 - National Museum of American History - DSC06247
self-published workcc-zero
World War II bench - Middleboro Veterans' Memorial Park - Middleborough, Massachusetts - DSC04043
self-published workpd text
World War II Memorial - Somerville Veterans Memorial Cemetery - Somerville, MA - 20191023 162419
self-published workblue
World War II memorial fountain, Class of 1943 - Dartmouth College - DSC04657
self-published workpd us no notice
General Electric WW2 Search light pic2
military related photographs by alf van beemcc-zero
Wat Ratchaburana (Bangkok) before destroied in World War II
monochromecity
Building city dome
buildingcity
Vacations cruise cruises
vehiclewater
20141030_Pielgrzymka_2
18th-century works in polandself-published work
8797_August_2018_in_Hrodna,_Belarus
self-published workpages with maps
8834_13th_of_August_2018_in_Hrodna_Region_Belarus
self-published workgrass
8929_2018_in_Masovian_Voivodeship
self-published worklight
8852_13th_of_August_2018_in_Poland
sidewalktraffic
8428_August_2018_in_Hrodna,_Belarus
peoplecity
8815_13th_of_August_2018_in_Hrodna_Region_Belarus
self-published workrural
Lamp-posts at Adelaide Crescent, Hove (IoE Code 365481)
self-published workadelaide crescent
Lamassu inscription 1 - Palace of Sargon II, Khorsabad - Oriental Institute Museum, University of Chicago - DSC07526
self-published workcc-zero
15501 - 15600 of 90,656 Next page
/ 907