74,019 Free Images of D

cc-zerorick d. westpages with mapsmilitaryvehicleaircraftaviationjetgroupair force
US Navy 100826-N-9818V-561 Master Chief Petty Officer of the Navy (MCPON) Rick West answers questions from chief petty officers during his visit to Republic of Korea
united states navy images from jinhaerick d. west
US Navy 100609-N-7526R-104 The coin of Master Chief Petty Officer of the Navy (MCPON) Rick West sits amongst hundreds of other military coins
landstuhl regional medical centerrick d. west
Paprastoji dumplūnė (Physalis alkekengi) Foto Algirdas, 2005 m. spalio 5 d.
plantsfood
Si tu es amoureux euse impossible de ne pas ecrire meat
springgrass
Domplatz 14 Eichstätt -D-1-76-123-56
architecturevillage
Cassette case comparison - regular, slim, ultraslim (3)
self-published work3 kinds
Image title: Brook floater and northern lance alasmidonta varicosa and elliptio fisheriana Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-d
animalsmollusk
Finance home switchboard operator
businesswoman
F-15C 159 FW, F-16C 169 FW, FA-18C VFA-131, F-14D VX-4 Cope Snapper (021023-F-XC395-013)
underwaterblue
Hans Holbein d. Ä.-Graue Passion-1058
pd-art (pd-old-auto)cc-pd-mark
Marienmünster - St. Jakobus d. Ä. und Christophorus - Chorgestühl - 1
interiorinside
Cosplay Field Taipei 2015 B Area and D Area 20150628
peoplegroup
Yamato International Tokyo Building
self-published workpages with maps
Yakovlev yak-11 za patrika i luisu
militaryvehicle
Oita Fragrance Museum, Perfumery Organ
self-published workpages with maps
Armored crane moves shipping containers while expanding the ROLE 3 Hospital on Kandahar Airport -d
international security assistance forcemilitary cranes
190812-N-UB406-0450 (48541925031)
oceansea
181222-D-PB383-085 (44606602020)
celebritiesgroup
C-2A landing on USS Eisenhower (CVN-69) 1983
vehiclenavy
French - Reliquary Shrine of St Martial - Walters 44119 - Side D
limoges enamel - 13th centurymedieval reliquaries
Mayan - Bowl - Walters 20092030 - Side D
7th-century pottery in the united statesbrown
US Navy 050216-N-0962S-154 Master Chief Petty Officer of the Navy (MCPON) Terry Scott testifies before the House Appropriations Committee, subcommittee on Military Quality of Life and Veteran's Affairs
people of the united states department of veterans affairsterry d. scott
US Navy 060602-N-0962S-058 Master Chief Petty Officer of the Navy (MCPON) Terry Scott flips through a photo album with seven-year-old Honorary Chief Hospital Corpsman (FMF) Diego Santiago
arlington countyvirginia
US Navy 090707-N-9818V-144 Master Chief Petty Officer of the Navy (MCPON) Rick West visits the K9 Kennel at Naval Air Facility Atsugi, Japan during his visit to the base
people at naval air facility atsugirick d. west
US Navy 101002-N-8335D-023 Damage Controlman 3rd Class Matthew Barrera uses a naval infrared thermal imager to check an engine room for hot spots d
engine rooms of the united states navyaboard uss harpers ferry (lsd-49)
US Navy 120120-N-IT566-277 Adm. Cecil Haney delivers remarks during the U.S. Pacific Fleet change of command ceremony
2012 in pearl harborcecil d. haney
US Navy 111102-N-XQ375-412 The Pakistani navy destroyer PNS Shahjahan (D 186), left, and the guided-missile cruiser USS Mobile Bay (CG 53) transit
general views of uss mobile bay (cg-53)1977
US Navy 050712-N-0962S-136 Three of the Navy's top Command Master Chiefs (CMCs) observe an all hands call by Master Chief Petty Officer of the Navy (MCPON) Terry Scott
terry d. scottgroup
US Navy 100302-N-9818V-039 Master Chief Petty Officer of the Navy (MCPON) Rick West visits Naval Service Training Command headquarters during his visit to Naval Station Great Lakes
naval station great lakesrick d. west
US Navy 100305-N-9818V-094 senior leadership speak congratulate Sailors at the 95th Navy Reserve Anniversary and Reenlistment ceremony
united states navy images from washingtond.c.,
US Navy 091215-N-9818V-034 Master Chief Petty Officer of the Navy (MCPON) Rick West reenlists a chief petty officer before a chief petty officer's call
reenlistmentgroup
US Navy 100108-N-8273J-300 Master Chief Petty Officer of the Navy (MCPON) Rick West meets with Sailors assigned to Role III Hospital at Kandahar Airfield, Afghanistan
militaryarmy
US Navy 100507-N-9818V-071 Master Chief Petty Officer of the Navy (MCPON) Rick West meets Con Crabb on the reviewing stand for the 61st Armed Forces Day Parade
rick d. westgroup
US Navy 100730-N-0569K-020 Machinist's Mate 3rd Class Daniel C. Hansen, left, and Electrician's Mate 3rd Class Chelsea D. Waters to power the pumps that align the aqueous film forming foam
aboard uss enterprise (cvn-65)skateboarding
US Navy 090402-N-9818V-070 Master Chief Petty Officer of the Navy (MCPON) Rick West takes questions from students attending Naval Technical Training Center at Naval Air Station Meridian
naval air station meridianrick d. west
US Navy 090305-N-9818V-110 Master Chief Petty Officer of the Navy (MCPON) Rick West meets with Sailors who recently returned from serving an Individual Augmentee
handshakes involving the militaryrick d. west
US Navy 090602-N-9818V-398 Master Chief Petty Officer of the Navy (MCPON) Rick West addresses guests at a book signing of
edward steichend.c.,
US Navy 070506-N-5330L-002 A plane director signals to the pilot of an F-A-18C Hornet, from the
flight deck of uss dwight d. eisenhower (cvn-69)strike fighter squadron 131 (united states navy)
US Navy 061230-D-1142M-021 Vice President Richard B. Cheney pays tribute to former President Gerald R. Ford during services at the U.S. Capitol Rotunda, Dec. 30, 2006
death and state funeral of gerald forddick cheney in 2006
Village pierre mountains
backgroundlandscape
Plant macro nature
naturespring
Mercedes-Benz 190 D EX-80-01 pic9
vehiclecar
Méréville (Essonne) Croix de chemin D 145
grassfield
Vitrail Chartres-116-d
self-published workcc-pd-mark
MiG-21PF Fishbed D, Czech air force 0308 pic3
militaryvehicle
MiG-21PF Fishbed D, Czech air force 0308 pic2
militaryvehicle
Robin DR.400slash120D DauphinD-EFRS
aircraftflight
Frankfurt, Hauptfriedhof, Grab adM 176 von Meyer
self-published workcc-zero
Frankfurt, Hauptfriedhof, Grab adM 216 von Heyden
self-published workcc-zero
Frankfurt, Hauptfriedhof, Grab adM 178 Rittershausen-Soemmerring
self-published workcc-zero
Frankfurt, Hauptfriedhof, bei Grab C 3 Lyraspielerin
1910 sculptures in frankfurt am mainself-published work
Frankfurt-Niederrad, Friedhof, Grab D 127 Ruhestätte der armen Dienstmägde Jesu Christi 1890-1906
self-published workcc-zero
CRJ900eurowingsD-ACNH
aircraftvehicle
Büttelgasse 4 Eichstätt -D-1-76-123-42
architectureroof
US Navy 110322-N-9643S-082 Sailors aboard the aircraft carrier USS George Washington (CVN 73) scrub the flight deck during a counter-measure wash d
ships at fleet activities yokosukavehicle
US Navy 110322-N-9643S-079 Sailors aboard the aircraft carrier USS George Washington (CVN 73) scrub the flight deck during a counter-measure wash d
wintersnow
F-8E(FN) CVN 69 folding wings
militaryaircraft
Flickr - Official U.S. Navy Imagery - An aircraft lands on the flight deck of the USS Dwight D. Eisenhower.
vehiclesea
US Navy 110804-N-PB383-070 Master Chief Petty Officer of the Navy (MCPON) Rick West speaks with service members during an all-hands call t Naval Ai
naval air station north island in the 2010srick d. west
US Navy 100730-N-9818V-063 Master Chief Petty Officer of the Navy (MCPON) Rick West visits the crew of (PCU) Missouri (SSN 780)
people at naval submarine base new londonrick d. west
US Navy 100305-N-9818V-082 Senior leadership speak before the 95th Navy Reserve Anniversary and Reenlistment ceremony
united states navy images from washingtond.c.,
US Navy 110220-N-5838W-002 Gunner's Mate 2nd Class Edward Shoman, left, supervises Electronics Technician 2nd Class Yusuf Smith as he fires a .50-c
navysr
US Navy 101129-N-1281L-010 Master Chief Petty Officer of the Navy Rick West speaks with Command Master Chief Linda Handley during his first visit t
aboard uss makin island (lhd-8)rick d. west
US Navy 100616-N-4236E-275 viation Boatswain's Mate (Handling) 2nd Class Bryant Simms directs an F-A-18F Super Hornet
strike fighter squadron 103 (united states navy)aboard uss dwight d. eisenhower (cvn-69)
US Navy 081219-N-0803S-011 Master Chief Petty Officer of the Navy (MCPON) Rick West prepares to serve lunch to Sailors and Marines
bahrainfood
US Navy 090428-N-9818V-136 Master Chief Petty Officer of the Navy (MCPON) Rick West speaks with Sailors during an all-hands call at the Bangor Theater at Naval Base Kitsap Bangor
people at naval base kitsaprick d. west
US Navy 090429-N-9818V-141 Master Chief Petty Officer of the Navy (MCPON) Rick West takes questions from Sailors at Naval Station Everett during an all-hands call at the Briefing Theater
naval station everettrick d. west
US Navy 090630-N-9818V-068 Master Chief Petty Officer of the Navy (MCPON) Rick West takes questions during an all-hands call from Seabees and Sailors assigned to Patrol Squadron (VP) 45
rick d. westcamp shields
US Navy 090706-N-9818V-494 Master Chief Petty Officer of the Navy (MCPON) Rick West speaks with U.S. Navy divers at U.S. Naval Ship Repair Facility, Yokosuka
militaryarmy
US Navy 030305-F-3050V-051 Top senior enlisted members during a hearing of the House Appropriations subcommittee on Military Construction
washingtond.c.,
Botanical specimen in the Denver Botanic Gardens, 1007 York Street, Denver, Colorado, USA.
natureplants
Print of the Eriocnemis godini from A Monograph of the Trochilidae, or family of humming-birds, 6 volumes, large folio (1849-87)d by J. Gould.
animalsbird
US Navy 100401-N-9818V-009 Master Chief Petty Officer of the Navy (MCPON) Rick West stands by the Lone Sailor statue
militaryarmy
US Navy 100106-N-3589B-042(1) Master Chief Petty Officer of the Navy (MCPON) Richard West has dinner with Sailors aboard USS Nimitz (CVN 68)
rick d. westgroup
US Navy 110316-N-EC642-047 Lt. j.g. Larron D. White, assigned to a security training team aboard High Speed Vessel Swift (HSV 2), teaches proper ha
united states navy images from san lorenzovalle
US Navy 111118-N-WJ771-256 Marines assigned to Combat Logistics Regiment 3 watch as a medium tactical vehicle replacement is loaded into the well d
aboard uss tortuga (lsd-46)oshkosh mtvr
US Navy 090822-N-9818V-318 Master Chief Petty Officer of the Navy (MCPON) Rick West cheers on racers participating in the fifth annual Run with the Chiefs 5 kilometer run at Naval Station Norfolk
naval station norfolkrick d. west
US Navy 090907-N-9818V-238 Master Chief Petty Officer of the Navy (MCPON) Rick West arrives in Taji to meet with the Sailors currently deployed there
militaryiraq
US Navy 090906-N-9818V-451 Master Chief Petty Officer of the Navy (MCPON) Rick West takes questions from Sailors during an all-hands call during a tour of Expeditionary Medical Facility Kuwait
camp arifjanrick d. west
US Navy 090325-N-9818V-147 Master Chief Petty Officer of the Navy (MCPON) Rick West addresses the chief petty officers stationed at National Naval Medical Center Bethesda
walter reed national military medical centerrick d. west
US Navy 111209-N-PB383-225 Hospital corpsmen assigned to the 11th Marine Expeditionary Unit (11th MEU) transport simulated casualties in the well d
pictures featuring members of the 11th marine expeditionary unitaboard uss new orleans (lpd-18)
181224-D-PB383-057 (31511183297)
united service organizations in the 2010skellie pickler
Frankfurt-Fechenheim, Friedhof, Grab B d-18 Schack
self-published workgarden
Rosengarten-D-1-f-Grace
naturespring
Taisnières-en-Thiérache (Nord, Fr) chapelle D
self-published workarchitecture
Lake Freighters moored in Toronto, 2012 03 02 -d
2012 in water transport in torontoself-published work
Klinikum Links der Weser - Hubschrauberlandeplatz
self-published worklawn
Frankfurt, Südfriedhof, D 181, Grab Rückmann-Schindler-Weinberg
self-published workfoliage
Gdańsk Oliwa przystanek autobusowy ulica Wita Stwosza
self-published work2011 in gdańsk
Dowdell knob
self-published workpages with maps
RI 4 Freedoms V trees TWC
sidewalktree
160605-N-WC455-086 (Image 1 of 29) 160605-N-WC455-086
militaryaircraft
161216-N-KK394-296 (32626931745)
peoplearmy
20190218_120232_Sheremetyevo_Airport_terminal_D_February_2019
passport controlshopping
Anna by J. D. Kestner, Germany, and baby doll, bisque heads circa 1900 - Fairbanks Museum and Planetarium - DSC04293
self-published workpd us expired
Snow wintry winter cold
landscapenature
Pallottine church pane sacred
stained glass windowsscenes
Tree ocean nature
landscapetravel
Scotland veterans burial
militaryarmy
Johann Baptist Lampi d. Ä. - Die Gräfinnen Caroline und Zoë Thomatis - 2427 - Österreichische Galerie Belvedere
portraits by johann-baptist lampi the elderfemale
17101 - 17200 of 74,019 Next page
/ 741